DPCfam | MC5004
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Residues in low-complexity regions (%) | 13.23 |
| Residues in coiled-coil regions (%) | 6.15 |
| Predicted disordered residues (%) | 57.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12083 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 88.46 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E2CSI9 | 40-148 | 109 | AERAEAKAERLDALGDKRSHQSNAFMRAADDLSQAFYMGQPILVGHHSEAKARKTQERMHNAMDKSVRAAKAVQYWQWKAAGVER... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GWG8-F1 | 88-196 | 96.46 | 91.80 | View in AlphaFoldDB ↗ |