DPCfam | MC500334
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 116 ± 13 aa |
| Residues in low-complexity regions (%) | 4.16 |
| Residues in coiled-coil regions (%) | 8.16 |
| Predicted disordered residues (%) | 13.82 |
| Average transmembrane regions | 0.24 |
| Dominant Pfam architecture(s) | PF13515 |
| Sequences matching dominant architecture (%) | 65.22 |
| Average overlap percent | 6.87 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B5RYA2 | 533-630 | 98 | LWPSWEFLNLNTHLKKSIEANKEYVKEITLYYNEKGEVTLPYKLARKYAFIEIGNLMASFQRMIQEPKSKQKYRTELYELAVLNH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P75870-F1 | 514-629 | 98.31 | 90.20 | View in AlphaFoldDB ↗ |