DPCfam | MC50033
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 5621 |
|---|---|
| Mean domain length (aa) | 166 ± 28 aa |
| Residues in low-complexity regions (%) | 1.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.84 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00145 |
| Sequences matching dominant architecture (%) | 90.0 |
| Average overlap percent | 63.91 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q3Z2V9 | 14-179 | 166 | DDAAIAMHRINHPHTLHLPHDIWRVNALRVTNGIRVGLGWFSPDCRHHSKAKGGRPVSKSVRDLPWVVAYWAKQVRPRILFLENV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F5M7-F1 | 12-177 | 94.68 | 91.95 | View in AlphaFoldDB ↗ |