DPCfam | MC500122
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 178 ± 23 aa |
| Residues in low-complexity regions (%) | 2.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K1WPL3 | 9-203 | 195 | AVLIALSFLFNKAQGVLWKDFWKKNQVIGYATVSEEQAKLINKDNKLYEGDELHVKRPPYALQTGSGFYILNGPGNWVRSSIDEE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GSY3-F1 | 36-218 | 96.05 | 91.37 | View in AlphaFoldDB ↗ |