DPCfam | MC499692
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Residues in low-complexity regions (%) | 1.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.93 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF07718 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 79.6 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q4YR16 | 34-125 | 92 | YSSTFLSKLHKSQAITSIDDDIFIEIFPIISTINLILEFYIYNQSGIDLQNIFINLSTHNNLKPIDKIPQFNLAPYEKKKFKTTI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3Q0KKR9-F1 | 762-863 | 93.58 | 78.33 | View in AlphaFoldDB ↗ |