DPCfam | MC499090
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 107 ± 25 aa |
| Residues in low-complexity regions (%) | 13.99 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.5 |
| Average transmembrane regions | 2.63 |
| Dominant Pfam architecture(s) | PF06772 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 31.89 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q9UQF9 | 44-141 | 98 | LWWSYFGYLRGGAERRLRGTTDRERSRLARDSYSYLHLPLVAGVVFFALGVHEAVAAPVEPLPLLPAVALAGGVAMFYVATSPTH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O33683-F1 | 260-364 | 99.06 | 90.41 | View in AlphaFoldDB ↗ |