DPCfam | MC49861
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Residues in low-complexity regions (%) | 0.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.89 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14033 |
| Sequences matching dominant architecture (%) | 99.22 |
| Average overlap percent | 10.8 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A1TPU2 | 2-81 | 80 | VDNSGNGPLQVPGFGGVPLDYERPGKDQFATIHDWAQRPAVTRRETVMVVVMETLTDRPDWQVDIFNDDVIQLWRQELAE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VSH1-F1 | 2-78 | 98.61 | 83.73 | View in AlphaFoldDB ↗ |