DPCfam | MC498608
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 411 |
|---|---|
| Mean domain length (aa) | 300 ± 49 aa |
| Residues in low-complexity regions (%) | 4.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.47 |
| Average transmembrane regions | 0.27 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006C95366 | 1034-1286 | 253 | RFGADHRVQETRKLLDSSKPIKICVMQRPDISDHELIEEQEKFLLALCTRTMALSIGRGMFTLRTSKPINTEQLPIPELCLSGKA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9H1A4-F1 | 1003-1279 | 95.83 | 88.27 | View in AlphaFoldDB ↗ |