DPCfam | MC498521
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 89 ± 11 aa |
| Residues in low-complexity regions (%) | 2.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.66 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09865 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 36.14 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M7XWR3 | 42-129 | 88 | IEPEAMTALNEMGNYLRTLKSFTVSSEMSMDEVLLSGQKILLTGTTEYSTRLPDRLRVSSKVEGLDRDNEYYYDGKSFTIYSNLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6N6J4-F1 | 95-133 | 47.13 | 93.62 | View in AlphaFoldDB ↗ |