DPCfam | MC49843
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 792 ± 40 aa |
| Residues in low-complexity regions (%) | 4.36 |
| Residues in coiled-coil regions (%) | 0.17 |
| Predicted disordered residues (%) | 21.96 |
| Average transmembrane regions | 0.33 |
| Dominant Pfam architecture(s) | PF10487- PF10487 |
| Sequences matching dominant architecture (%) | 52.0 |
| Average overlap percent | 59.77 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q0UCF1 | 7-795 | 789 | PELDLTKCFTGEQQLVTWDIAYRALCDPETATNSDPLRAFLSANENKQILSRPWKPFPDPSSQEKSKFEAKTAPIKVTPSSNSHY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W5M7-F1 | 8-794 | 99.14 | 85.77 | View in AlphaFoldDB ↗ |