DPCfam | MC498353
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 192 ± 16 aa |
| Residues in low-complexity regions (%) | 1.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.09 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02589 |
| Sequences matching dominant architecture (%) | 99.25 |
| Average overlap percent | 92.94 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J4RKE6 | 59-261 | 203 | DQLKSKAVQKIEEQHIKVFQAKTPEEAKKIAIKLIPRGSKVVKSKSNVVNEIGLEDYLVKETDFTDTDCGDFIVQITEERPAHPV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8T2H6-F1 | 32-223 | 99.50 | 97.09 | View in AlphaFoldDB ↗ |