DPCfam | MC498323
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Residues in low-complexity regions (%) | 3.02 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.41 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00069 |
| Sequences matching dominant architecture (%) | 0.97 |
| Average overlap percent | 13.64 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00085A83F7 | 48-137 | 90 | GDDLRKSLAWDKAFFTNAGVLEPDELCHMIESNHVLGEKRVLATIQEDVKRSTESISSTLKSDCCSTVETSHQDRVLFEDVVTAS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9LFI5-F1 | 79-172 | 98.95 | 63.93 | View in AlphaFoldDB ↗ |