DPCfam | MC498185
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1871 |
|---|---|
| Mean domain length (aa) | 125 ± 18 aa |
| Residues in low-complexity regions (%) | 3.43 |
| Residues in coiled-coil regions (%) | 6.01 |
| Predicted disordered residues (%) | 30.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03449- PF01272 |
| Sequences matching dominant architecture (%) | 44.84 |
| Average overlap percent | 92.66 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S8ICD9 | 14-153 | 140 | KKLEDELELLRSVKRHEVAQRLHEAIEEGGELEENAAYEVAKTEQAFLEGRIREIEEKLGQAIVIEPSAPTDEAQIGSTVIVQEN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B9L822-F1 | 28-154 | 95.35 | 94.89 | View in AlphaFoldDB ↗ |