DPCfam | MC498051
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 279 ± 33 aa |
| Residues in low-complexity regions (%) | 1.18 |
| Residues in coiled-coil regions (%) | 0.39 |
| Predicted disordered residues (%) | 17.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05168 |
| Sequences matching dominant architecture (%) | 43.48 |
| Average overlap percent | 27.29 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A143NJ97 | 3-308 | 306 | LIDLELQVEELPLWQRPLRASIKFVLESILDIRGDTKEDFAGKPWFAVIFHHIETWYRDTYGSAFDQSSGEGFASGVVLVRHVPI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58700-F1 | 12-71 | 22.58 | 97.40 | View in AlphaFoldDB ↗ |