DPCfam | MC497905
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 95 ± 8 aa |
| Residues in low-complexity regions (%) | 0.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.9 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18755 |
| Sequences matching dominant architecture (%) | 92.38 |
| Average overlap percent | 90.6 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C1E0G7 | 72-168 | 97 | RSAVSLKMLVESGHMQAGPDALWISYLNKTWSAELDAEGVIKFEGNEYNSPSAWAIFCKRIANPGKKADDGWKSVRYGEADGPTL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3TV65-F1 | 63-155 | 98.94 | 85.93 | View in AlphaFoldDB ↗ |