DPCfam | MC497795
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 104 ± 19 aa |
| Residues in low-complexity regions (%) | 3.29 |
| Residues in coiled-coil regions (%) | 48.86 |
| Predicted disordered residues (%) | 45.33 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10267 |
| Sequences matching dominant architecture (%) | 98.26 |
| Average overlap percent | 44.98 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00064AF065 | 35-97 | 63 | LQSSLKHCTLHLSEQLREEKAGWDENTVDNLKLISRADQHQVDLEKVNQCTFATIAHIERCLC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A044SRY5-F1 | 54-183 | 99.17 | 72.71 | View in AlphaFoldDB ↗ |