DPCfam | MC497696
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 108 ± 20 aa |
| Residues in low-complexity regions (%) | 12.8 |
| Residues in coiled-coil regions (%) | 0.3 |
| Predicted disordered residues (%) | 10.51 |
| Average transmembrane regions | 1.58 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J3PE23 | 304-405 | 102 | SLLVTLPDGRKVCLRGTAADLAGAAGSAWLRAETHVEGYLEAAAKLCVHLVAAVSGNWTQAGALVVMLLLLVSAALLALSNANAR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GST2-F1 | 211-326 | 99.15 | 92.98 | View in AlphaFoldDB ↗ |