DPCfam | MC497365
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 79 ± 10 aa |
| Residues in low-complexity regions (%) | 1.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.4 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09520 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 36.29 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008FF83CF | 39-117 | 79 | RFHLLRGVNRPQVQSYYAMPYNPYGVNKADYKWTQAKSYLPFDKAVVIGNEFWSIVGGATAYEELLEIYLEVGREKSKY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P25257-F1 | 189-269 | 94.12 | 95.85 | View in AlphaFoldDB ↗ |