DPCfam | MC497294
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 271 ± 25 aa |
| Residues in low-complexity regions (%) | 2.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.1 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF09343 |
| Sequences matching dominant architecture (%) | 0.93 |
| Average overlap percent | 21.87 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00055EBE7C | 365-623 | 259 | RTIFQNRIYEAQQATQTRPDVGALESAWLDLGPVNSLRMFDGKIGSVTETEGDLEVVLQVEGIADGLALFGLQAGSVQLEILDSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NAA1-F1 | 187-242 | 19.93 | 80.67 | View in AlphaFoldDB ↗ |