DPCfam | MC49724
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 126 ± 11 aa |
| Residues in low-complexity regions (%) | 1.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17652 |
| Sequences matching dominant architecture (%) | 95.0 |
| Average overlap percent | 15.01 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E8U3C3 | 626-748 | 123 | LYLGRNPDYLKANYDHLGREPQAWRDIFWEMYALYDAAGAVAKFGSGSYTPEEGESKAHTYHWIHNLNAMGRLDTGVTGNIPTSV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q09850-F1 | 632-693 | 48.03 | 97.61 | View in AlphaFoldDB ↗ |