DPCfam | MC497182
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 371 |
|---|---|
| Mean domain length (aa) | 67 ± 10 aa |
| Residues in low-complexity regions (%) | 1.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.94 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07075 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 15.12 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A177RAA3 | 4-61 | 58 | GIDVLKRDKFAPLRGLRVGLITNHTGMDRERNATIDLLRAAPELQLKVLFSPEHGIRG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P40407-F1 | 37-103 | 97.01 | 93.24 | View in AlphaFoldDB ↗ |