DPCfam | MC49700
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 258 ± 46 aa |
| Residues in low-complexity regions (%) | 13.53 |
| Residues in coiled-coil regions (%) | 7.4 |
| Predicted disordered residues (%) | 2.71 |
| Average transmembrane regions | 6.09 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A2A8733 | 78-334 | 257 | GPLWAEAFKTWKSAWDIHVYLFATSFLIMGFYAAYYVVFNLYDGLEQKYLSVSLNIMVLVFCLTRAFVMYLDPYHQGDIIKALQL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9V4B6-F1 | 605-902 | 97.72 | 76.76 | View in AlphaFoldDB ↗ |