DPCfam | MC496954
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 138 ± 16 aa |
| Residues in low-complexity regions (%) | 0.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13620 |
| Sequences matching dominant architecture (%) | 16.39 |
| Average overlap percent | 26.57 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M9E225 | 424-587 | 163 | QRTDKNGEFSVNGIPRYLDNGNEITDFVVTIYPKDYAEQSQGQKRVGESITFVCKQERITGSVVDSSGSSIPDGVVVAVKVYRKL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O86488-F1 | 699-747 | 36.30 | 93.36 | View in AlphaFoldDB ↗ |