DPCfam | MC496871
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 233 ± 27 aa |
| Residues in low-complexity regions (%) | 4.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.66 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03640- PF03640- PF03640- PF03640 |
| Sequences matching dominant architecture (%) | 47.31 |
| Average overlap percent | 94.23 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D8D1N1 | 1221-1466 | 246 | ADTPSGTQVDNNGCPVSTPVNREVASASGLLVGGADSSFPGFTLYRFDNDSAGQSNCFDTCAQSWPPLLVTDGVPSGIPQQSDLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HTJ9-F1 | 49-150 | 48.62 | 96.27 | View in AlphaFoldDB ↗ |