DPCfam | MC496856
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Residues in low-complexity regions (%) | 4.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.56 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D6JI14 | 5-123 | 119 | EPEETIGIYWHRMIGGASTYRHYPQAAVSLDALRRRLAILFHALGGSGAVRISAGAPFDTGHRLSLKQRIGLGRERIEHAVLDTS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q51484-F1 | 7-134 | 99.22 | 77.08 | View in AlphaFoldDB ↗ |