DPCfam | MC496434
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 130 ± 16 aa |
| Residues in low-complexity regions (%) | 1.73 |
| Residues in coiled-coil regions (%) | 6.67 |
| Predicted disordered residues (%) | 30.43 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I2KMV1 | 29-187 | 159 | LLFFLIVTCVLIATFFISFYGYLSYIEYEKEEAKAKDNGIRISDTTSSINNHVSSVKRETISLITNIHNALNDSICYDNTPDENF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O60645-F1 | 48-149 | 76.56 | 84.31 | View in AlphaFoldDB ↗ |