DPCfam | MC49597
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 471 |
|---|---|
| Mean domain length (aa) | 65 ± 10 aa |
| Residues in low-complexity regions (%) | 1.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.39 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | PF02705 |
| Sequences matching dominant architecture (%) | 97.79 |
| Average overlap percent | 15.94 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E3JRQ0 | 274-345 | 72 | YDYLSGVILCLTGSEAMFANLSQFNKSSIRIAFAGFVYPMLILTYLGQGARLSKDPSIVSSIFYLSIPGPVG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O80739-F1 | 330-400 | 98.61 | 90.15 | View in AlphaFoldDB ↗ |