DPCfam | MC4957
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 111 ± 13 aa |
| Residues in low-complexity regions (%) | 3.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13569 |
| Sequences matching dominant architecture (%) | 99.28 |
| Average overlap percent | 48.63 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A074M042 | 1048-1156 | 109 | VDEDIDPADFSQIKLAHSTLLDADTRSAWATHIVDYDVKPLFDQLGRLLPEISDATRKQRLINDREGWMIETFKLRGIATKLGYQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q32EJ2-F1 | 265-377 | 98.26 | 95.21 | View in AlphaFoldDB ↗ |