DPCfam | MC495235
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 192 ± 25 aa |
| Residues in low-complexity regions (%) | 10.82 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 67.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11831 |
| Sequences matching dominant architecture (%) | 96.23 |
| Average overlap percent | 63.08 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R3WWS3 | 1-187 | 187 | LALQQVQTPLKGGDNTELSTSVVNIVGATPQARHLPTPNILLPNQLAANTPFRTPQVGVTPGGPNDVTNQTPRRDYLNINETDSM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E9QIC1-F1 | 370-578 | 100.00 | 61.30 | View in AlphaFoldDB ↗ |