DPCfam | MC495136
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 347 ± 47 aa |
| Residues in low-complexity regions (%) | 6.21 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 9.27 |
| Average transmembrane regions | 4.27 |
| Dominant Pfam architecture(s) | PF07681 |
| Sequences matching dominant architecture (%) | 41.99 |
| Average overlap percent | 25.31 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1H6JQZ9 | 7-336 | 330 | NICRIVLALTFIFSGFVKAVDPLGTQYKIQDYLVAIGLGRMMPDFTTLASSVLLAATEFFLGICLLFAIRRRIVSKLVLAIMVVM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q45FN5-F1 | 12-341 | 97.18 | 81.70 | View in AlphaFoldDB ↗ |