DPCfam | MC495003
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 96 ± 8 aa |
| Residues in low-complexity regions (%) | 2.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07364 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 35.75 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S5XND2 | 14-113 | 100 | RIALGGFNHETNTFCSTATRLEDFTLPGPYPGLLRGAEVLSGLAGSNLPATGFFDEMAAAEPVWQLIPTLWTAAAPSGVVPADVF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q93CA6-F1 | 30-128 | 99.00 | 97.57 | View in AlphaFoldDB ↗ |