DPCfam | MC49487
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 83 ± 10 aa |
| Residues in low-complexity regions (%) | 2.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01107 |
| Sequences matching dominant architecture (%) | 88.24 |
| Average overlap percent | 24.07 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0J8CBZ7 | 17-88 | 72 | KNLDGWKYPKIPVDQVYKKKILSSPNSIVKDFEQTITLKASNQNTSAKLLSRDLLKGFIKKQHEFLHLGLIQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7MD40-F1 | 44-129 | 97.67 | 62.78 | View in AlphaFoldDB ↗ |