DPCfam | MC494865
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 83 ± 4 aa |
| Residues in low-complexity regions (%) | 0.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.37 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF18404 |
| Sequences matching dominant architecture (%) | 98.97 |
| Average overlap percent | 32.05 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8B9P0 | 1367-1450 | 84 | MELDLHGAPYGYTPFCDSRTSMGGFRFWKSGYWASHLAGRKYHISALYVVDLLKFRQIAAGDRLRGQYQGLSADPNSLSNLDQD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D8PJN6-F1 | 1254-1337 | 100.00 | 93.24 | View in AlphaFoldDB ↗ |