DPCfam | MC494281
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 111 ± 12 aa |
| Residues in low-complexity regions (%) | 3.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.44 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q9LAQ4 | 81-199 | 119 | KTAIEIKRELRNGDADFAMRVLAMAADYFDGLGPADRRKFLEKPSSTGRKRWDALIARTLAYKCRQHGMKAPTWTLIQPLSSKWY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O53298-F1 | 127-233 | 93.10 | 88.37 | View in AlphaFoldDB ↗ |