DPCfam | MC494138
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 64 ± 8 aa |
| Residues in low-complexity regions (%) | 3.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.38 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08533 |
| Sequences matching dominant architecture (%) | 67.5 |
| Average overlap percent | 90.43 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I0GZN7 | 581-647 | 67 | EAGVAPVLEDLPPQVEAVRRGALVFLLNHGVAEAVVPLPEPGTDAITGNPVGRSAIVEAGGFMVIRT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9KI47-F1 | 614-675 | 95.31 | 95.67 | View in AlphaFoldDB ↗ |