DPCfam | MC494016
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 471 |
|---|---|
| Mean domain length (aa) | 68 ± 8 aa |
| Residues in low-complexity regions (%) | 1.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.22 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01197 |
| Sequences matching dominant architecture (%) | 83.75 |
| Average overlap percent | 95.19 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E3DJH5 | 1-80 | 80 | MKPKIHPVYRKVVFHDTTADAYFVVGSTIKTDRTIQHEGEDMPYVPLDVSSASHVYYTGKQKDFAKEGSAARFNQRFGSF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0Q4M1-F1 | 1-67 | 98.51 | 79.89 | View in AlphaFoldDB ↗ |