DPCfam | MC493794
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 269 ± 53 aa |
| Residues in low-complexity regions (%) | 2.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.27 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07752 |
| Sequences matching dominant architecture (%) | 56.7 |
| Average overlap percent | 88.32 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L3Q3T1 | 3-134 | 132 | CCEEYRLVTGETLDLGSGYELTVKQIYVKDDEVWMELSKEGVLIDDEIIDISDGGTWILDMDIEGENDVVVFRTHVNNLLKDGNL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8PVI7-F1 | 321-586 | 98.86 | 96.79 | View in AlphaFoldDB ↗ |