DPCfam | MC493664
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 227 ± 36 aa |
| Residues in low-complexity regions (%) | 2.36 |
| Residues in coiled-coil regions (%) | 2.1 |
| Predicted disordered residues (%) | 28.14 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05667 |
| Sequences matching dominant architecture (%) | 1.96 |
| Average overlap percent | 2.32 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P6IVK5 | 3-251 | 249 | CAACIGDATESHVRCRGFCTETFHPRCTGISADTFEEVMKNQQLFWLCPSCTSLMKDIRFRNTARAAHDFGHDQAIHSQSDTLQH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9W0C3-F1 | 17-235 | 97.55 | 75.76 | View in AlphaFoldDB ↗ |