DPCfam | MC493611
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 135 ± 15 aa |
| Residues in low-complexity regions (%) | 5.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 38.94 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C7YUF4 | 346-483 | 138 | IPFSIDMSKLDDLFPSVEASFPTPEPVPDVIIDDTFASISERKAWYQISRFGSIRKHNMGDDENYVRIGWSNSQVREQAIRIVRR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VPP6-F1 | 377-514 | 96.35 | 67.67 | View in AlphaFoldDB ↗ |