DPCfam | MC493478
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 3361 |
|---|---|
| Mean domain length (aa) | 359 ± 51 aa |
| Residues in low-complexity regions (%) | 2.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.99 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF13589- PF01119 |
| Sequences matching dominant architecture (%) | 70.25 |
| Average overlap percent | 85.48 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D5NZ03 | 4-297 | 294 | LSAETVRLLSSSQVITSVVSVVKELIENSLDASATTIDIRLENYGFDKIEVRDNGNGIKVADVPVMAIKHYTSKISSSEDLERLT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P40692-F1 | 8-333 | 99.65 | 90.18 | View in AlphaFoldDB ↗ |