DPCfam | MC493399
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 118 ± 13 aa |
| Residues in low-complexity regions (%) | 10.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06224 |
| Sequences matching dominant architecture (%) | 13.46 |
| Average overlap percent | 57.67 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A1UCD8 | 885-1002 | 118 | LLAELLGRVELRELLDADVIAATARQLQHLAEDRRAKDAEGVADLLRLLGPLTSEEIAERSTTDDVGGWLEGLLSAKRVLTVSFA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8F979-F1 | 100-210 | 99.11 | 84.03 | View in AlphaFoldDB ↗ |