DPCfam | MC49319
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 130 ± 13 aa |
| Residues in low-complexity regions (%) | 1.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.85 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF04931 |
| Sequences matching dominant architecture (%) | 98.28 |
| Average overlap percent | 17.28 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0V1Q6Q3 | 342-466 | 125 | SSHERKYWGFEIFIKFLTSMKSTEISSLFTQNFMRCLINQSSQQNRILNKISSKVLNIIIDNSNKDFTKAPIILECLIDESKGGC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NSC1-F1 | 326-453 | 98.44 | 95.08 | View in AlphaFoldDB ↗ |