DPCfam | MC492967
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 111 ± 9 aa |
| Residues in low-complexity regions (%) | 1.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.75 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08553 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 34.64 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1C7M0C8 | 579-686 | 108 | PPLGDPITGIDVTANGRWIVATTRTYLLLIDTLIGEGRYTGSLGFDRSFPANAKPIPRRLQLRAEHVAYMEHSVSFTPARFNMGE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D8PP94-F1 | 583-691 | 100.00 | 92.59 | View in AlphaFoldDB ↗ |