DPCfam | MC492912
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 213 ± 28 aa |
| Residues in low-complexity regions (%) | 1.46 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13229 |
| Sequences matching dominant architecture (%) | 2.86 |
| Average overlap percent | 75.23 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004B9FAB2 | 9-214 | 206 | GAFRIGADIEDLTLEHMQATNVQRFIENSISGDNSSASVDGLTVRDVHINKYAEFGIKLAYNSRNIVIEDTTGVGDPNTPEKYVS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0CMU3-F1 | 245-354 | 40.43 | 97.73 | View in AlphaFoldDB ↗ |