DPCfam | MC492859
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 69 ± 10 aa |
| Residues in low-complexity regions (%) | 1.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.11 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF13469 |
| Sequences matching dominant architecture (%) | 62.5 |
| Average overlap percent | 28.17 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P6YFK7 | 10-84 | 75 | IVYIAGYGRSGSTLLDILLNAHPYIFGAGELTEIFEAAAARTPCSCGQPLDACAIWSYVLNHLPAHTTPAEAEHL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EXP3-F1 | 8-71 | 88.57 | 97.64 | View in AlphaFoldDB ↗ |