DPCfam | MC49285
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 277 ± 38 aa |
| Residues in low-complexity regions (%) | 3.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06239- PF14784 |
| Sequences matching dominant architecture (%) | 72.09 |
| Average overlap percent | 93.5 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3WF59 | 26-280 | 255 | EAGPQDKARFVQAVRAFGQRNAHRRGHVDFIYLALRKMRDFGLERDRAAYHLLLDVFPKDVFRARSFLQRLFVHYPRQQECGVAV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9U6M0-F1 | 64-367 | 99.31 | 88.01 | View in AlphaFoldDB ↗ |