DPCfam | MC49245
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 326 ± 29 aa |
| Residues in low-complexity regions (%) | 6.85 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03435 |
| Sequences matching dominant architecture (%) | 10.53 |
| Average overlap percent | 24.64 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q5AWC3 | 31-351 | 321 | EAMDAAMTAEKLRPQSLTVHTRTVDMTNVEAVAEAIDQAAPDVLLQAAIPRSWYSFPHRFDPVTWRRLNREARMGPWLPLFMLLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9KRL3-F1 | 4-88 | 24.49 | 97.97 | View in AlphaFoldDB ↗ |