DPCfam | MC492357
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 781 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Residues in low-complexity regions (%) | 0.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.41 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF02811 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 41.49 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F4TNY2 | 89-164 | 76 | PNHLTVLAANADGYKNLTQLVSLASLEGFYSKPRIDRELLEKHRRGLVVLSGCVKGEIPSLLMQDKVKEAREVAAW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8XJR3-F1 | 625-701 | 100.00 | 93.30 | View in AlphaFoldDB ↗ |