DPCfam | MC49170
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 541 |
|---|---|
| Mean domain length (aa) | 343 ± 76 aa |
| Residues in low-complexity regions (%) | 4.59 |
| Residues in coiled-coil regions (%) | 0.08 |
| Predicted disordered residues (%) | 17.67 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF04499 |
| Sequences matching dominant architecture (%) | 61.54 |
| Average overlap percent | 39.37 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A9T9F9 | 11-372 | 362 | TSPVEAVLDKDAYTLEELLDEDEIIQECKALNSRLINFMRGKAQVHALLRYVVEEPPEGADNKRSYKFPFIACEIFTCEIDVIFK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8R3Q2-F1 | 11-378 | 100.00 | 89.55 | View in AlphaFoldDB ↗ |