DPCfam | MC49137
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 266 ± 37 aa |
| Residues in low-complexity regions (%) | 9.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 38.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14472- PF14472- PF09851 |
| Sequences matching dominant architecture (%) | 51.52 |
| Average overlap percent | 95.58 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F7FX52 | 4-261 | 258 | LRTALGELTVPLEAVAEVSFEPGRKHDRLRLRLREGADPLTQATGGKLPAVADPYLLEVPHDRADAARELAAEITEAVRTAQVPA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8FG61-F1 | 29-80 | 13.21 | 74.20 | View in AlphaFoldDB ↗ |